DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and zgc:123284

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001032488.1 Gene:zgc:123284 / 641422 ZFINID:ZDB-GENE-051113-92 Length:256 Species:Danio rerio


Alignment Length:252 Identity:57/252 - (22%)
Similarity:103/252 - (40%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LITGAASGIGAAAAEMFSKL---------GACLALVDREEEGLIC-VMKRCMKMGHEPYGIAG-D 70
            |:|||..|:|   .||..:|         .||     |:.:|... |::...|...:...:.. |
Zfish    10 LVTGANRGLG---LEMVKQLLEADCSKIFAAC-----RDTDGPNSEVLRELAKKNPDVVTLVKLD 66

  Fly    71 LLKPPEIECIARKTTERY-EGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLL 134
            :..|..|:..|:|..... |..|::|||.|.|:|..|:.:..:....:....||....::.:..|
Zfish    67 VADPASIKESAKKVGSLLGEKGLNLLVNNAAILPQKTMLTCSVEDMHNTFNTNVIGPLFVIREYL 131

  Fly   135 PQLLQC------------KGSIVNVSS-VCGLRAFPN------LVAYNMSKAAVDQFTRSLALDL 180
            |.|...            |.:::|:|: ...|...|:      |..|::||.|::..|...|.||
Zfish   132 PYLRAAVKASGKPGMSPGKAAVINISTDAASLSMIPSMKEPFPLFPYSISKVALNMLTVYTARDL 196

  Fly   181 GPQGVRVNAVNPGVIRTN-----------------LQKAGGMDEQSYAEFLEHSKKT 220
            ....:...:::||.:||:                 |:..|.:.|:....:::::.||
Zfish   197 KADEILCISIHPGWVRTDMGSYEATLDTRESVEGMLRVIGSLTEKDQGGYMDYTGKT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 57/252 (23%)
NADB_Rossmann 11..261 CDD:304358 57/252 (23%)
zgc:123284NP_001032488.1 adh_short 8..215 CDD:278532 52/212 (25%)
carb_red_sniffer_like_SDR_c 9..256 CDD:187586 57/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.