DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and BDH2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 / 56898 HGNCID:32389 Length:259 Species:Homo sapiens


Alignment Length:270 Identity:93/270 - (34%)
Similarity:135/270 - (50%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPY-GIAG---DLLK 73
            |||:::|.||.|||.|||..|::.||.:...|..|..|         ...|.| ||..   |:.|
Human     6 GKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKL---------QELEKYPGIQTRVLDVTK 61

  Fly    74 PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLL 138
            ..:|:..|.:..     :||||.|.||.:..||:...|...:...|..||||.:.:.|..||::|
Human    62 KKQIDQFANEVE-----RLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKML 121

  Fly   139 -QCKGSIVNVSSVCG----------------LRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVR 186
             |..|:|:|:|||..                ||.. |...|:.:||||...|:|:|.|...||:|
Human   122 AQKSGNIINMSSVASSVKVMATDDEKLRLPMLRVV-NRCVYSTTKAAVIGLTKSVAADFIQQGIR 185

  Fly   187 VNAVNPGVIRT-NLQ---KAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFV 247
            .|.|.||.:.| :||   :|.|..|::..:||:..|    .||....:|:|....:|||:.:::|
Human   186 CNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQK----TGRFATAEEIAMLCVYLASDESAYV 246

  Fly   248 TGVTLPVDGG 257
            ||..:.:|||
Human   247 TGNPVIIDGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 91/268 (34%)
NADB_Rossmann 11..261 CDD:304358 93/270 (34%)
BDH2XP_006714337.1 DHRS6_like_SDR_c 5..259 CDD:187626 93/270 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.