DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and zgc:163083

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001077028.1 Gene:zgc:163083 / 566848 ZFINID:ZDB-GENE-070424-53 Length:257 Species:Danio rerio


Alignment Length:264 Identity:54/264 - (20%)
Similarity:101/264 - (38%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLITGAASGIGAAAAEMFSK-----------------LGACLALVDREEEGLICVMKRCMKMGHE 63
            :|||||..|:|....:..|:                 ..|.|..:.::...||.:::.       
Zfish     9 ILITGANRGLGLEMVKQLSENSCPKHIFATCRDPDGPKSAALRELAKKHPNLITIIRL------- 66

  Fly    64 PYGIAGDLLKPPEIECIARKTTERYEGK-LDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGF 127
                  |...|..|:..|:|........ |::|||.|.|:..||:|::.:....:....||    
Zfish    67 ------DADDPCSIKESAKKVGSLVGANGLNLLVNNAAIVANGTIQTSSVEDLKNTFNTNV---- 121

  Fly   128 YLTKLLL-----------------PQLLQCKGSIVNVSSV-CGLRAFPNL------VAYNMSKAA 168
             :..||:                 |.:...|.:|:|:|:| ..:...|.:      :.|.:|||.
Zfish   122 -IGPLLIIREYRPYLQIAAKASGTPGMSSKKAAIINISTVAASMTRMPPIYSHFQTLPYAVSKAG 185

  Fly   169 VDQFTRSLALDLGPQGVRVNAVNPGVIRTN-----------------LQKAGGMDEQSYAEFLEH 216
            .:..|...|.::....:...|::||.::|:                 |:..||:.|:.:..||::
Zfish   186 FNMLTVLAAEEVKTDEILCMALHPGWVKTDLGGRDATLEPNESVEGMLKVIGGLTEKQHGGFLDY 250

  Fly   217 SKKT 220
            :..|
Zfish   251 TGAT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 54/264 (20%)
NADB_Rossmann 11..261 CDD:304358 54/264 (20%)
zgc:163083NP_001077028.1 carb_red_sniffer_like_SDR_c 9..257 CDD:187586 54/264 (20%)
adh_short 9..216 CDD:278532 47/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.