DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and si:dkey-12e7.4

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001137514.1 Gene:si:dkey-12e7.4 / 558132 ZFINID:ZDB-GENE-050419-83 Length:256 Species:Danio rerio


Alignment Length:254 Identity:64/254 - (25%)
Similarity:106/254 - (41%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLITGAASGIGAAAAEM-----FSKLGACLALVDREEEGLICVMKRCMKMGHEPYG---IAGDLL 72
            ::||||:.|:|....|.     ||. |..:|.. |...|    .|...::..|...   |..|::
Zfish    11 LMITGASRGLGLQIVESLVTGGFSP-GKIIATA-RNPNG----AKELQRLAEEYQNIHIIKLDVI 69

  Fly    73 KPPEIECIARKTTE--RYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLP 135
            ....||..|.:..|  :.|| |:.|:|.|||.....|::............|..:...:||.:||
Zfish    70 SQESIERAAAEVEELVQEEG-LNCLINNAGINVVANLETVTADQMLENFHTNSVAPLMITKAMLP 133

  Fly   136 QLLQC----------KGSIVNVSSVCG------------LRAFPNLVAYNMSKAAVDQFTRSLAL 178
            .|.:.          :.:::||:|:.|            .:.:|    |..||:|::..||.||:
Zfish   134 LLKRAAAKGTGMGIHRAAVINVTSLLGSVELYWGDRADTFKWYP----YRTSKSALNMVTRCLAV 194

  Fly   179 DLGPQGVRVNAVNPGVIRTN-----------------LQKAGGMDEQSYAEFLEHSKKT 220
            ||...|:...|::||.:||:                 |...||:.|:.:..||.::.:|
Zfish   195 DLEADGILCMALHPGWVRTDMGGPEAPLSPEESISSVLSVIGGLTEKDHGSFLHYTGET 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/254 (25%)
NADB_Rossmann 11..261 CDD:304358 64/254 (25%)
si:dkey-12e7.4NP_001137514.1 carb_red_sniffer_like_SDR_c 12..256 CDD:187586 64/253 (25%)
adh_short 13..218 CDD:278532 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.