Sequence 1: | NP_730973.1 | Gene: | CG31546 / 40691 | FlyBaseID: | FBgn0051546 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018493.1 | Gene: | dhrs7cb / 553684 | ZFINID: | ZDB-GENE-050522-226 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 55/201 - (27%) |
---|---|---|---|
Similarity: | 88/201 - (43%) | Gaps: | 19/201 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGL------ICVMKRCMKMGHEP---YGIAG 69
Fly 70 DLLKPPEIECIARKTTERYE--GKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKL 132
Fly 133 LLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIR 196
Fly 197 TNLQKA 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31546 | NP_730973.1 | fabG | 9..257 | CDD:235975 | 55/201 (27%) |
NADB_Rossmann | 11..261 | CDD:304358 | 55/201 (27%) | ||
dhrs7cb | NP_001018493.1 | 11beta-HSD1_like_SDR_c | 35..309 | CDD:187593 | 55/201 (27%) |
adh_short | 38..219 | CDD:278532 | 53/187 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573294 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |