DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and dhrs7cb

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb / 553684 ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio


Alignment Length:201 Identity:55/201 - (27%)
Similarity:88/201 - (43%) Gaps:19/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGL------ICVMKRCMKMGHEP---YGIAG 69
            |||:||.|.||:|:..|.:|...||.|.|.....:.|      :|       .|.:|   :....
Zfish    38 KVVVITDAVSGMGSECARLFHAGGARLVLCGPSWDKLESLYDSLC-------SGSDPSQTFTPKL 95

  Fly    70 DLLKPPEIECIARKTTERYE--GKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKL 132
            .||...::|.|:...:|..|  |.:|||:..:.:.....:|:..|.....:|:.|......|.|.
Zfish    96 VLLDFSDMENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKG 160

  Fly   133 LLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIR 196
            :||.::..: |..|.|:|:.|..|.|....|..||.||..|...|..::...|:.|:.::...|.
Zfish   161 VLPLMITRRTGQFVLVNSIQGKLALPFRTCYAASKHAVQAFFDCLRAEVEEFGISVSTISHTFIN 225

  Fly   197 TNLQKA 202
            ...:.|
Zfish   226 AGAENA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 55/201 (27%)
NADB_Rossmann 11..261 CDD:304358 55/201 (27%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 55/201 (27%)
adh_short 38..219 CDD:278532 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.