DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and zgc:109982

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001018379.1 Gene:zgc:109982 / 553564 ZFINID:ZDB-GENE-050522-139 Length:318 Species:Danio rerio


Alignment Length:202 Identity:53/202 - (26%)
Similarity:89/202 - (44%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLL-KPPEI 77
            |||||||.:||||.:.|...:.        |.::..::....|...........||..| :..||
Zfish     4 KVVLITGCSSGIGLSLAVRIAN--------DEKKRFMVYATMRNTAKAEALKEAAGQTLGQTLEI 60

  Fly    78 E------------CIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT 130
            :            |:.....    ||:|:|::.||:...|.::...:.....||:.|......|.
Zfish    61 KQLDVCDENSIRACVDSLPM----GKIDILISNAGVGMIGPVECQTIEEMKSVMDTNFFGLVRLL 121

  Fly   131 KLLLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGV 194
            |::||.:.:.| |.||.:||:.|::.......|..||.||:.|..|||:......:.::.:.||.
Zfish   122 KVVLPDMKRRKSGHIVVISSIMGIQGILFNDIYAASKFAVEGFCESLAVQAMRFNLNISLIEPGP 186

  Fly   195 IRTNLQK 201
            :.|..::
Zfish   187 VITEFER 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 53/202 (26%)
NADB_Rossmann 11..261 CDD:304358 53/202 (26%)
zgc:109982NP_001018379.1 NADB_Rossmann 4..261 CDD:304358 53/202 (26%)
adh_short 4..198 CDD:278532 53/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.