Sequence 1: | NP_730973.1 | Gene: | CG31546 / 40691 | FlyBaseID: | FBgn0051546 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018379.1 | Gene: | zgc:109982 / 553564 | ZFINID: | ZDB-GENE-050522-139 | Length: | 318 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 53/202 - (26%) |
---|---|---|---|
Similarity: | 89/202 - (44%) | Gaps: | 26/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLL-KPPEI 77
Fly 78 E------------CIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT 130
Fly 131 KLLLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGV 194
Fly 195 IRTNLQK 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31546 | NP_730973.1 | fabG | 9..257 | CDD:235975 | 53/202 (26%) |
NADB_Rossmann | 11..261 | CDD:304358 | 53/202 (26%) | ||
zgc:109982 | NP_001018379.1 | NADB_Rossmann | 4..261 | CDD:304358 | 53/202 (26%) |
adh_short | 4..198 | CDD:278532 | 53/202 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573244 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X68 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |