DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and zgc:112146

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001017731.1 Gene:zgc:112146 / 550426 ZFINID:ZDB-GENE-050417-237 Length:256 Species:Danio rerio


Alignment Length:260 Identity:57/260 - (21%)
Similarity:103/260 - (39%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LITGAASGIGAAAAEMFSKL---------GAC----------LALVDREEEGLICVMKRCMKMGH 62
            |:|||..|:|   .||..:|         .||          |..:.|:..|::.::|.      
Zfish    10 LVTGANRGLG---LEMVKQLLEAHCSKVFAACRDPDGPNSEVLRELARKHLGVVTLVKH------ 65

  Fly    63 EPYGIAGDLLKPPEIECIARKTTERY-EGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSG 126
                   |:..|..|:..|.|..... |..|::|||.|.|:|..|:.:..:....:....||...
Zfish    66 -------DIADPSSIKESAEKVGSLLGEKGLNLLVNNAAILPQKTMLTATVEDMHNAFNTNVIGP 123

  Fly   127 FYLTKLLLPQL------------LQCKGSIVNVSS-VCGLRAFPNL------VAYNMSKAAVDQF 172
            .::.:..||.|            ..||.:::|:|: ...:...|::      ..|::|||.::..
Zfish   124 LFVIREYLPYLRAAAKASGKPGMSSCKAAVINISTDSASMSMIPSMKDPFPFFPYSISKAGLNML 188

  Fly   173 TRSLALDLGPQGVRVNAVNPGVIRTN-----------------LQKAGGMDEQSYAEFLEHSKKT 220
            |...|.||....:...:::||.:||:                 |:..|.:.|:....|::::.||
Zfish   189 TVYTARDLKADEILCISIHPGWVRTDMGTNEATLDTRESVEGMLRVIGSLTEKESGGFVDYTGKT 253

  Fly   221  220
            Zfish   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 57/260 (22%)
NADB_Rossmann 11..261 CDD:304358 57/260 (22%)
zgc:112146NP_001017731.1 carb_red_sniffer_like_SDR_c 9..256 CDD:187586 57/260 (22%)
adh_short 9..218 CDD:278532 51/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.