DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and pecr

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr / 550422 ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio


Alignment Length:269 Identity:76/269 - (28%)
Similarity:126/269 - (46%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGI--- 67
            |||| |:.||.::||..:|||.|......:||..:.:..|:.|.|        |...|...:   
Zfish     8 KAGL-FNHKVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERL--------KSAAEELTLKIP 63

  Fly    68 AGDLLKPPEIECIARK---------TTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANV 123
            :....|...|||..|.         :|.:..|::|.|||..|...:..........:..|::.|:
Zfish    64 SSSPAKVTPIECNIRNEDEVKNLMASTLKLHGRIDFLVNNGGGQFSSPANMMSAKGWKAVIDTNL 128

  Fly   124 RSGFYLTKLLLPQLLQCKGSIVNVSSVCGL-RAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRV 187
            ...|...:......::..|.:: |:.:..: :.||.:.....::||||..|:|||::....|||:
Zfish   129 NGTFLCCREAYNAWMKDHGGVI-VNIIADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRI 192

  Fly   188 NAVNPGVIRTNLQKAGGMDEQSYAEFL-EHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVT 251
            |:|.||.|   :.|....:.:.|...| :.|.......|:|.|:|::.|:|||.|..|:::||.|
Zfish   193 NSVAPGTI---ISKTAMENYKEYGPTLFKMSVPFSPAKRLGVPEEISPAVCFLLSPAANYITGAT 254

  Fly   252 LPVDGGKQV 260
            |.||.|:.:
Zfish   255 LKVDAGQSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 72/261 (28%)
NADB_Rossmann 11..261 CDD:304358 72/264 (27%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 64/246 (26%)
TER_DECR_SDR_a 28..263 CDD:187627 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.