DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Dhrs1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_081095.2 Gene:Dhrs1 / 52585 MGIID:1196314 Length:313 Species:Mus musculus


Alignment Length:201 Identity:57/201 - (28%)
Similarity:92/201 - (45%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEI 77
            |:|.::|||:.|||...|....|.||.:.:..|..:.|....:....:|.....:..|..:..|:
Mouse     7 GQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRATAQEAQSLGGRCVPVVCDSSQESEV 71

  Fly    78 ECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTE-------LACFTHVMEANVRSGFYL-----T 130
            :.:..:.....:|:||||||.|.......|.:|.       .:.:..:....:| |.||     .
Mouse    72 KSLFEQVDREQKGRLDVLVNNAYAGVQAILNTTNKSFWEVPASIWDDINNVGLR-GHYLCSVYGA 135

  Fly   131 KLLLPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVI 195
            :|::|   ..||.||.|||..||:...| |.|.:.|||.|:.....|.:|...||...::.||::
Mouse   136 RLMVP---AGKGLIVIVSSPGGLQHMFN-VPYGVGKAACDRLAADCAHELRRHGVSYVSLWPGLV 196

  Fly   196 RTNLQK 201
            :|.:.|
Mouse   197 QTEMVK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 57/201 (28%)
NADB_Rossmann 11..261 CDD:304358 57/201 (28%)
Dhrs1NP_081095.2 DHRS1-like_SDR_c 5..271 CDD:187664 57/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.