DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and pecr

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_031749362.1 Gene:pecr / 496922 XenbaseID:XB-GENE-1009809 Length:300 Species:Xenopus tropicalis


Alignment Length:264 Identity:80/264 - (30%)
Similarity:131/264 - (49%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPP 75
            |..||.::||..:|||.|.|.....||..:.:..|:.|.|    |...|........|...|..|
 Frog    12 FRNKVAIVTGGGTGIGKAIAAELLGLGCSVIIASRKLERL----KETAKELTSRIAPASPALLTP 72

  Fly    76 EIECIAR---------KTTERYEGKLDVLV-NGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT 130
             ::|..|         |:|....|::|.|| ||.|..|:.: ::.....:..|::.|:...||..
 Frog    73 -LQCNIRREEEVETLVKSTLGLHGRIDFLVNNGGGQFPSPS-EAISAKGWNAVIDTNLTGTFYCC 135

  Fly   131 KLLL-PQLLQCKGSIVNVSSVCGL-RAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPG 193
            |.:. ..:.:..|:|||:  |..: :.||.:.....::||||..|:|||::....|||:|:|.||
 Frog   136 KAVYNAWMKEHGGAIVNI--VADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPG 198

  Fly   194 VI--RTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDG 256
            .|  :|.::....|..|.:..::   .|..| .|:|.|:||:..:|||.|..:||::|.|:.:|.
 Frog   199 TIFSQTAVENYKDMGPQLFQSYI---PKIPA-KRLGLPEEVSPTVCFLLSPASSFISGETIKIDA 259

  Fly   257 GKQV 260
            |:.:
 Frog   260 GQSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 79/259 (31%)
NADB_Rossmann 11..261 CDD:304358 80/264 (30%)
pecrXP_031749362.1 TER_DECR_SDR_a 28..263 CDD:187627 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.