DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG7601

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:273 Identity:82/273 - (30%)
Similarity:118/273 - (43%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPP-- 75
            |||||||||:||:|.:.|.:|.:.|..:.|..|..:.|..|.|..:.:..:|       ..||  
  Fly    53 GKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDP-------AYPPTV 110

  Fly    76 ------EIECIARKTTE--RYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKL 132
                  |:..|....|.  ....::|:|:|..||.....:.||.:.....||..|......|||.
  Fly   111 LPLDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKA 175

  Fly   133 LLPQLL-QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIR 196
            |||.:: :..|.|..:|||.|..|.|...||:.||.|:..|..||..::..:.:.|:.|:||.||
  Fly   176 LLPSMVKRGSGHICFISSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIR 240

  Fly   197 TNL---------QKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAI--CFLASELASFVTGV 250
            |.|         ...|.:||            |.|.|.  .|.::|..|  |.|..|....|:.|
  Fly   241 TQLSLNALTGSGSSYGKVDE------------TTAKGM--SPDKLAERILQCILRKEPDIIVSDV 291

  Fly   251 TLPVDGGKQVMCP 263
            ...:....:.:||
  Fly   292 QAKIAYYLRHLCP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 80/265 (30%)
NADB_Rossmann 11..261 CDD:304358 80/269 (30%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 82/273 (30%)
PRK06181 53..314 CDD:235726 82/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.