DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG5590

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:116/316 - (36%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKGKAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEE------GLI-CVMKRCM 58
            |.:.||    .:|:.:.||||:.|||...|...::.||.:.:..:..|      |.| ...:...
  Fly     1 MINTGK----LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIE 61

  Fly    59 KMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANV 123
            |.|.:.|....|:....::.........:: |.:|:::|.|..:.......|::..:..:...|.
  Fly    62 KAGGKAYPCVVDVRDEQQVRSAVEAAVAKF-GGIDIVINNASAISLTNTPDTDMKRYDLMHNINT 125

  Fly   124 RSGFYLTKLLLPQLLQCK-GSIVNVSSVCGLRA--FPNLVAYNMSKAAVDQFTRSLALDLGPQGV 185
            |..|.::|:.||.|.:.. ..|:|:|....::.  |...|||.|:|..:......:|.:...:|:
  Fly   126 RGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGI 190

  Fly   186 RVNAVNPG-------------------------------VIRTN---------------LQKAGG 204
            .|||:.|.                               .|.|.               |:.||.
  Fly   191 SVNALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVDDEVLESAGI 255

  Fly   205 MDEQSYAEFLEHSKKTHA---LGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            .|...||.|.|::.|...   :...|.|.|..||    |.:.|:       |..||
  Fly   256 TDLTEYACFRENADKLMVDFFVEEKGAPVENEAA----AEDAAA-------PASGG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/306 (21%)
NADB_Rossmann 11..261 CDD:304358 66/306 (22%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 49/244 (20%)
PRK08278 7..277 CDD:181349 56/270 (21%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435183
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.