DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG8757

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:273 Identity:66/273 - (24%)
Similarity:113/273 - (41%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALV------DREEE---GLICVMKRCMKMGHEPYGIAG 69
            ||.:::||::|||||...  :.:||.:.:|      :|.|:   ||      .::.....:.|..
  Fly     7 KVAVVSGASAGIGAACTR--ALIGAGMIVVGLARRHERVEKLRSGL------SLEQQSRLHAIKC 63

  Fly    70 DLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTL-QSTELACFTHVMEANVRSGFYLTKLL 133
            |:.:..:: ..|...|.|..|.:||||:.|||:.||.| :..:.......:|.|:....|..:..
  Fly    64 DITQEDQV-LKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRES 127

  Fly   134 LPQLLQ--CKGSIVNVSSVCGLRA------FPNLVAYNMSKAAV--------DQFTRSLALDLGP 182
            ...:.:  .:|.:|.|:||.|.:.      .|:|..|..:|.|:        .:|.|.      .
  Fly   128 FRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRH------K 186

  Fly   183 QGVRVNAVNPGVIRTNL--QKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELAS 245
            ..|||:.|:||::.|.:  ::..|:.:|..............|..||.|..|.            
  Fly   187 TAVRVSTVSPGIVDTVILPEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQ------------ 239

  Fly   246 FVTGVTLPVDGGK 258
             |..:|:...|.|
  Fly   240 -VHNITIKPQGEK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/270 (24%)
NADB_Rossmann 11..261 CDD:304358 66/273 (24%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 66/273 (24%)
NADB_Rossmann 1..247 CDD:304358 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.