DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:202 Identity:63/202 - (31%)
Similarity:99/202 - (49%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMG-HEPYGIAGDLLKPPE 76
            |..||:|||::|||...|..:::|||.:.:..|....|..|:.:|.:|| .:.:.|..|:..|.:
Zfish    33 GARVLVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMANPSD 97

  Fly    77 IECIARKTTERYEGKLDVLV-NGAGIMP----TGTLQSTELACFTHVMEANVRSGFYLTKLLLPQ 136
            .:.:.:...|:. |.||.|| |..|..|    .|.:|.|.     .::|.|..|...:.:..||.
Zfish    98 ADLVVKYAIEQL-GGLDYLVLNHIGPSPYQMWDGDVQHTR-----WLLEVNFLSYLQMAQKALPT 156

  Fly   137 LLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQ--GVRVNAVNPGVIRTN- 198
            |.:.|||||.|||:.|....|..:.|..:|.|::.|...|..:|..|  .|.:.....|:|.|: 
Zfish   157 LEKSKGSIVVVSSLLGKICGPFALPYASTKFALNGFFGGLQNELAMQKSNVSITICILGLIDTDS 221

  Fly   199 -LQKAGG 204
             ::|..|
Zfish   222 AMEKIKG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 63/202 (31%)
NADB_Rossmann 11..261 CDD:304358 63/202 (31%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 63/202 (31%)
adh_short 36..229 CDD:278532 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.