DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG10672

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:249 Identity:85/249 - (34%)
Similarity:139/249 - (55%) Gaps:9/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPE 76
            :|||.::|.:..|||.|.|:..::.||.:.:..|:::.:...:....|:....:|:...:.:|.:
  Fly    70 AGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPED 134

  Fly    77 IECIARKTTERYEGKLDVLVNGAGIMPT--GTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQ 139
            .:.:..:|..:: |||::||:.|...|.  |.|:..| ..:..:.:.||:|.:.|.|..||.|.|
  Fly   135 RKQLFEETISKF-GKLNILVSNAATNPAVGGVLECDE-KVWDKIFDVNVKSSYLLAKEALPLLRQ 197

  Fly   140 CK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAG 203
            .| .|||.|||:.|..||..|.||::||.|:...|::.|.||.|:|:|||.:.||||||...|| 
  Fly   198 QKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKA- 261

  Fly   204 GMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
             :.|...|.  |.:.....:||:|..:|:|..:.||.||.|.::||.::...||
  Fly   262 -LYENESAN--EAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 83/247 (34%)
NADB_Rossmann 11..261 CDD:304358 85/249 (34%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 85/249 (34%)
fabG 67..316 CDD:235975 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435187
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.