DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and HSD11B1L

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:243 Identity:79/243 - (32%)
Similarity:109/243 - (44%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMG-HEPYGIAGDLLKPPE 76
            |..||:|||.:|:|...|..:::||:.|.|....|..|..|:..|.|:| .:.:.||.|:..|..
Human    76 GARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRKLGAPKVFYIAADMASPEA 140

  Fly    77 IECIARKTTERYEGKLDVLV-NGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQC 140
            .|.:.:...::. |.||.|| |..|..|.||...:..|. ..:|:.|..|...||...||.|...
Human   141 PESVVQFALDKL-GGLDYLVLNHIGGAPAGTRARSPQAT-RWLMQVNFVSYVQLTSRALPSLTDS 203

  Fly   141 KGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGGM 205
            |||:|.|||:.|.........|:.:|.|:|.|..||..:|..|.|.| |:...|:       |..
Human   204 KGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNV-AITMCVL-------GLR 260

  Fly   206 DEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLP 253
            |..|.||.:....:..|   ...||...|.|...|:..|    ||..|
Human   261 DRASAAEAVRGVTRVKA---APGPKAALAVIRGGATRAA----GVFYP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 79/243 (33%)
NADB_Rossmann 11..261 CDD:304358 79/243 (33%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 79/243 (33%)
PRK08251 78..302 CDD:181324 78/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.