DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and dhrs1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001002205.1 Gene:dhrs1 / 368670 ZFINID:ZDB-GENE-030616-591 Length:310 Species:Danio rerio


Alignment Length:244 Identity:65/244 - (26%)
Similarity:103/244 - (42%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPE 76
            ||.:.::|||:.|||...|...|:.||.:.:..|:|:.|........:.|.....:..|..|..:
Zfish     4 SGWICVVTGASRGIGRGIALQLSEAGATVYITGRQEKSLKQTAAEVAERGGRCLPVVCDSSKEED 68

  Fly    77 IECIARKTTERYEGKLDVLVNGA--------------------GIMPTGTLQSTELACFTHVMEA 121
            |:.:..:......|:||:|||.|                    ||.  .|:.:|.|         
Zfish    69 IKELFERVEREQNGRLDILVNNAYAGVQAILDNVSKKFWEVDPGIW--DTINNTGL--------- 122

  Fly   122 NVRSGFYLTKLLLPQLL--QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQG 184
               .|.|...:...:|:  |.||.||.:||:.|||...| |.|.:.|||.|:....:.::|..:|
Zfish   123 ---RGHYFCSVYAARLMVAQGKGLIVVISSMGGLRYLFN-VPYGVGKAACDRMAADMGIELKKRG 183

  Fly   185 VRVNAVNPGVIRTNL------QKAG--GMDEQSYAEFLEHSKKTHALGR 225
            |...::.||.::|..      |..|  |.|.: |.:...:.:.|...||
Zfish   184 VASVSLWPGAVQTETIKQYMSQDEGPPGFDSK-YKDVFTNGETTELSGR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 65/244 (27%)
NADB_Rossmann 11..261 CDD:304358 65/244 (27%)
dhrs1NP_001002205.1 PRK08303 1..267 CDD:236229 65/244 (27%)
DHRS1-like_SDR_c 3..268 CDD:187664 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.