Sequence 1: | NP_730973.1 | Gene: | CG31546 / 40691 | FlyBaseID: | FBgn0051546 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373557.1 | Gene: | hsd20b2 / 368367 | ZFINID: | ZDB-GENE-030804-21 | Length: | 329 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 62/200 - (31%) |
---|---|---|---|
Similarity: | 97/200 - (48%) | Gaps: | 21/200 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCM-KMGHEPYGIAGDLLKPPE 76
Fly 77 IECIARKTTERYEG-KLDVLVNGAGIMPTGTLQSTELACF----------THVMEANVRSGFYLT 130
Fly 131 KLLLPQLLQ-CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGV 194
Fly 195 IRTNL 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31546 | NP_730973.1 | fabG | 9..257 | CDD:235975 | 62/199 (31%) |
NADB_Rossmann | 11..261 | CDD:304358 | 62/199 (31%) | ||
hsd20b2 | NP_001373557.1 | 17beta-HSD1_like_SDR_c | 54..296 | CDD:187614 | 62/199 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D913128at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |