DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and hsd20b2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:200 Identity:62/200 - (31%)
Similarity:97/200 - (48%) Gaps:21/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCM-KMGHEPYGIAGDLLKPPE 76
            |:..::|||.||||.|.||..:|.|..:.|:.|.||.|..|.|... |...:.:.|..|.   .|
Zfish    54 GRWAVVTGATSGIGRAYAEELAKRGLNIVLISRSEEKLHRVAKEIEDKYNQKTHVIQADF---TE 115

  Fly    77 IECIARKTTERYEG-KLDVLVNGAGIMPTGTLQSTELACF----------THVMEANVRSGFYLT 130
            ...|....|::.|| ::.:|||..|:...|.     ||.|          |.|:..|..|...:.
Zfish   116 GHSIYSTITKQLEGLEIGILVNNVGMNYIGV-----LANFLDVPDPDQRITQVLNCNTLSVTQMC 175

  Fly   131 KLLLPQLLQ-CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGV 194
            :::||.::: .||.|:|:||..|.:..|.:..|:.:||.|..|:..|..:...:|:.|..|.|.:
Zfish   176 RVILPGMVERGKGLIINISSEAGYQPVPMVSLYSATKAFVTYFSLGLNAEYRSKGITVQCVAPFM 240

  Fly   195 IRTNL 199
            :.||:
Zfish   241 VSTNM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 62/199 (31%)
NADB_Rossmann 11..261 CDD:304358 62/199 (31%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.