DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Hsd17b8

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006256026.1 Gene:Hsd17b8 / 361802 RGDID:1303158 Length:273 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:118/252 - (46%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITGAASGIGAAAAEMFSKLGACLALVDRE---EEGLICVMKRCMKMGHEPYG----IAGDLLKPP 75
            |:||.||||.|.:...:..||.:|..|.:   .:..:.::........||.|    ...|:.:.|
  Rat    16 ISGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAFQADVSEGP 80

  Fly    76 EIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQC 140
            ..:.:..:....:.....|:|:.|||.....|.......:..|:..|::..|.:|:.....|:..
  Rat    81 AAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSS 145

  Fly   141 --KGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNL-QKA 202
              :|||:|:||:.|.........|..|||.|...|::.|.:||..|:|.|:|.||.|.|.: || 
  Rat   146 GGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQK- 209

  Fly   203 GGMDEQSYAEFLEHSKKTHA---LGRIGEPKEVAAAICFLASELASFVTGVTLPVDG 256
              |.|:.       ..|..|   ||.:|:|::||..:.|||||.:.::||.::.|.|
  Rat   210 --MPEKV-------KDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 73/252 (29%)
NADB_Rossmann 11..261 CDD:304358 73/252 (29%)
Hsd17b8XP_006256026.1 BKR_SDR_c 16..257 CDD:187594 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.