DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and ZK697.14

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001024318.1 Gene:ZK697.14 / 3565013 WormBaseID:WBGene00022809 Length:249 Species:Caenorhabditis elegans


Alignment Length:225 Identity:61/225 - (27%)
Similarity:97/225 - (43%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCM--KMGHEPYGIAGDLLK--PPE 76
            :|||||..|||....:.|.|           .||:..|:..|.  ....|...||...|:  |.|
 Worm     6 ILITGANRGIGLGLVKQFLK-----------NEGIQLVIATCRNPSKADELNSIADSRLQIFPLE 59

  Fly    77 IEC--IARKTTERYE-----GKLDVLVNGAGIMPT----GTLQSTELACFTHVMEANVRSGFYLT 130
            |:|  ..:|..|..:     ..|.||:|.|.|...    |.:..|.:   ...:|.|..|...||
 Worm    60 IDCDDSIKKLYENVDTLVGTDGLTVLINNAAICSVYEIEGQISRTYM---RQQIETNSVSTAILT 121

  Fly   131 KLLLPQLLQC------------KGSIVNVSSVCGLRAF-----PNL-VAYNMSKAAVDQFTRSLA 177
            :..:|.|.:.            :.:|||:||......:     |.: :||.|||:|::.|::|.:
 Worm   122 QNFIPLLKKASAKNGGEEYSTDRAAIVNISSGAASIGYIDDKQPGIYIAYRMSKSALNSFSKSCS 186

  Fly   178 LDLGPQGVRVNAVNPGVIRTNLQKAGGMDE 207
            ::|....:.|.|:.||.::|::....|.:|
 Worm   187 VELAKYHILVTAMCPGWVKTDMGGENGWEE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 61/225 (27%)
NADB_Rossmann 11..261 CDD:304358 61/225 (27%)
ZK697.14NP_001024318.1 carb_red_sniffer_like_SDR_c 6..248 CDD:187586 61/225 (27%)
adh_short 6..211 CDD:278532 59/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.