DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG13284

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:206 Identity:61/206 - (29%)
Similarity:97/206 - (47%) Gaps:28/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPY-----GIA 68
            :|..|:..::|||..|||...|...::.|..|.|:.|.:|.||.|....    ...|     .||
  Fly    66 VDKFGQWAVVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEI----ESQYKVKTKWIA 126

  Fly    69 GDLLKPPEIECIARKTTERYEGKL-----DVLVNGAGIM---PTG-TLQSTELACFTHVMEANVR 124
            .|..|       .|:..::.|.:|     .:|||..|:|   |.. .|.|.:|  ..:::..|:.
  Fly   127 ADFAK-------GREVYDQIEKELAGIDVGILVNNVGMMYEHPESLDLVSEDL--LWNLLTVNMG 182

  Fly   125 SGFYLTKLLLPQLL-QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVN 188
            |...||:.:|||:: :.||:|||:.|...|:..||:..|..||..|..|:::|.|::....:.|.
  Fly   183 SVTMLTRKILPQMIGRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQ 247

  Fly   189 AVNPGVIRTNL 199
            .|.|..:.|.:
  Fly   248 LVMPNFVVTKM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 61/206 (30%)
NADB_Rossmann 11..261 CDD:304358 60/204 (29%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 60/202 (30%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.