DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and cbr1l

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_919360.1 Gene:cbr1l / 337696 ZFINID:ZDB-GENE-030131-9642 Length:277 Species:Danio rerio


Alignment Length:293 Identity:73/293 - (24%)
Similarity:101/293 - (34%) Gaps:112/293 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLG--ACLALVDREE------------EGL---------ICV 53
            |.||.::|||..|||.|..:...|.|  ..:.|..|.|            ||.         ||.
Zfish     2 SKKVAVVTGANKGIGLAIVKGLCKAGFTGDILLTARNEKLGQEAIAGLQSEGFKNVVFHQLDICD 66

  Fly    54 MKRCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHV 118
            ...|||:                     :|..|...|.||||:|.|||    ..::.....|...
Zfish    67 QGSCMKL---------------------KKFLEEKYGGLDVLINNAGI----AFKNAATEPFGEQ 106

  Fly   119 MEANVRSGFYLT----KLLLPQLLQCKGSIVNVSS---------------------------VCG 152
            .|..:|:.|:.|    ..||| :|:....:|||||                           :|.
Zfish   107 AEVTMRTNFWGTLWACHALLP-ILRANARVVNVSSFVSKKSLDQCSAELQAKFRNKDLSEEELCL 170

  Fly   153 L---------------RAFPNLVAYNMSKAAVDQFTRSLALDLGP----QGVRVNAVNPGVIRTN 198
            |               :.:|| .||..:|..|...:|..|..|..    .|:.:||..||.:||:
Zfish   171 LMGEFVQDAQAGDHSAKGWPN-TAYGTTKIGVTVLSRIQARVLNETRPGDGILLNACCPGWVRTD 234

  Fly   199 LQKAG---------GMDEQSYAEFL-EHSKKTH 221
            :  ||         |.:...|...| |.:|:.|
Zfish   235 M--AGPKAPKSPEEGAETPVYLAMLPEGAKEPH 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 73/293 (25%)
NADB_Rossmann 11..261 CDD:304358 73/293 (25%)
cbr1lNP_919360.1 carb_red_PTCR-like_SDR_c 4..277 CDD:187585 72/291 (25%)
adh_short 4..242 CDD:278532 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.