DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG40486

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster


Alignment Length:256 Identity:57/256 - (22%)
Similarity:98/256 - (38%) Gaps:66/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPE-- 76
            :|.::|||:||||||.|......|..:..:.|..:.:..:.::.                |||  
  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL----------------PPELQ 55

  Fly    77 -----IEC---------IARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGF 127
                 |.|         .|....|...|..|:|||.||.:..|.|.:.||.....|:..|:....
  Fly    56 GRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVV 120

  Fly   128 YLTKLLLPQLLQ--CKGSIVNVSSVCGLRAFPN--------LVAYNMSKAAVDQFTRSLALDLGP 182
            ..|:.....:.|  ..|.::.::|:.| |...|        |..|.::|..|......|..:|  
  Fly   121 ICTRRAFRSMQQREVDGHVILINSLTG-RNIINPPGDELQVLNMYPLTKHGVTAMLEVLRQEL-- 182

  Fly   183 QG----VRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFL 239
            :|    ::|.::.|||..|.:..:|                 :.:..:.:|.::||.|.::
  Fly   183 RGFKTKIKVTSITPGVTDTEILPSG-----------------YGILPMLKPDDIAAGIMYV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 57/256 (22%)
NADB_Rossmann 11..261 CDD:304358 57/256 (22%)
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 57/256 (22%)
NADB_Rossmann 1..242 CDD:304358 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.