DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG7322

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster


Alignment Length:257 Identity:92/257 - (35%)
Similarity:133/257 - (51%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKP 74
            |.:|||:|:|||.:|||.|..:..:..||.:..|.|:.|.|      ...:..:|..|     :|
  Fly     4 DLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQL------QQLVAFDPVHI-----QP 57

  Fly    75 PEIECIARKTTERYEGK---LDVLVNGAG---IMPTGTLQSTELACFTHVMEANVRSGFYLTKLL 133
            .:::....:.......|   ||.|||.||   |.|...|  ||....|| .:.|:::.|.:|:.|
  Fly    58 LQLDLSGWQAVREGLAKVPLLDGLVNNAGVAIIKPFEEL--TEQDFDTH-FDVNIKAVFNVTQSL 119

  Fly   134 LPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTN 198
            ||: |:...|||||||:...|:|....||:.:|||:|..|:||||:|||:.:|||:|||.|:.|.
  Fly   120 LPR-LKDGASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTK 183

  Fly   199 LQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQV 260
            :......|.......|.|.    .|.|..|.:||..|..:|.|..:|||.|..:.::||..|
  Fly   184 MGADNWSDPAKSGPLLAHI----PLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGYSV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 89/252 (35%)
NADB_Rossmann 11..261 CDD:304358 91/256 (36%)
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 92/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.