DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG31937

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:112/256 - (43%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KGKAGLDFS---GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPY 65
            |.:.|:..|   |:||.||||:||||.|.|...::.|..|.|..|..|.|..|.:.|:       
  Fly    34 KSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECL------- 91

  Fly    66 GIAGDLLKPPEIECIARKTTERYEGK------------LDVLVNGAGIMPTGTLQSTELACFTHV 118
            ..|..||...::..|.....:..|.|            ||||||.||.....:....|:.....:
  Fly    92 AAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDREL 156

  Fly   119 MEANVRSGFYLTKLLLPQLLQ---CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDL 180
            .|.:|.:..:|::|::...::   .:|.|...||:.|....|....|..:|.|::.:..||.:::
  Fly   157 FELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEM 221

  Fly   181 GPQGVRVNAVNPGVIRTN-LQKA-----GGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAA 235
              :.:.|:...||.|.|: ||:|     ||....|.|     ::|.....|.|:...||.|
  Fly   222 --RKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTA-----NQKRMTAQRCGDLFAVALA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 70/251 (28%)
NADB_Rossmann 11..261 CDD:304358 70/249 (28%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 69/246 (28%)
adh_short 47..245 CDD:278532 58/206 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
32.840

Return to query results.
Submit another query.