DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and hsdl2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_955893.1 Gene:hsdl2 / 322347 ZFINID:ZDB-GENE-030131-1066 Length:415 Species:Danio rerio


Alignment Length:253 Identity:63/253 - (24%)
Similarity:105/253 - (41%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEE----------------------GLICVM 54
            :|..:.||||:.|||.|.|...::.||.:.:..:..:                      .|.|::
Zfish     9 AGCTIFITGASRGIGKAIALKAAQDGANVVIAAKTADPHPKLPGTIYTAAAEIEAAGGKALPCIV 73

  Fly    55 KRCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGA-GIMPTGTLQSTELACFTHV 118
                           |:....:|.....:..|:: |.:|:|||.| .|..||||| |.:.....:
Zfish    74 ---------------DVRDEKQINDAVEQAVEKF-GGIDILVNNASAINLTGTLQ-TPMKKADLM 121

  Fly   119 MEANVRSGFYLTKLLLPQLLQCKG-SIVNVSSVCGLRA--FPNLVAYNMSKAAVDQFTRSLALDL 180
            :..|:|..:..:||.:|.||:.|. .|:|:|....|..  |.|..||.::|..:......:|.:.
Zfish   122 LGINLRGTYLTSKLCIPHLLKSKNPHILNLSPPLNLNPIWFKNHTAYTIAKYGMSMCVLGMAEEF 186

  Fly   181 GPQG-VRVNAVNPGVIRTNLQKA-----GG------------MDEQSYAEFLEHSKKT 220
              :| :.|||:.|   :|.:|.|     ||            |.:.:||.|.:.:..|
Zfish   187 --RGSIAVNALWP---KTAIQTAAMDMLGGSEVGKQCRKVEIMADAAYAIFKQPTSFT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 63/253 (25%)
NADB_Rossmann 11..261 CDD:304358 63/253 (25%)
hsdl2NP_955893.1 HSDL2_SDR_c 8..248 CDD:187663 63/253 (25%)
adh_short 12..210 CDD:278532 55/219 (25%)
SCP2 311..408 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.