DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and antdh

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:90/225 - (40%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSGKVVLITGAASGIGAAAAEMFSKLGACLA----LVDREEE--------------GLICVMKRC 57
            :..:|.::|||:||||:|.|:.....|..:.    .|||.:|              .|.|     
  Fly     4 WQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYC----- 63

  Fly    58 MKMGHEPYGIAGDLLKPPEIECIARKTTERYE------GKLDVLVNGAGIMPTGTLQSTELACFT 116
             .:|:|                  ....|.::      |.:|||||.||.:..|.|.....|...
  Fly    64 -DVGNE------------------SSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQ 109

  Fly   117 HVMEANVRSGFYLTKLLLPQLLQCK--GSIVNVSSVCGLRAF-------PNLVAYNMSKAAVDQF 172
            .|::.|:......|:..:..:.:.|  |.:|.::|:.|.:..       |::..|..||.||...
  Fly   110 QVLQTNIMGIVLCTQRAVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTAL 174

  Fly   173 T---RSLALDLGPQGVRVNAVNPGVIRTNL 199
            .   |.....||.: :::.:|:|||:.|.:
  Fly   175 AEGYRQEFFGLGTR-IKITSVSPGVVDTEI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 53/225 (24%)
NADB_Rossmann 11..261 CDD:304358 53/225 (24%)
antdhNP_572695.2 YdfG 1..250 CDD:226674 53/225 (24%)
NADB_Rossmann 1..245 CDD:304358 53/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.