DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG31810

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:232 Identity:70/232 - (30%)
Similarity:103/232 - (44%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYG-----IAGDLL 72
            |...::|||..|||...|...::.|..|.||.|:||.||.|..   ::|.: |.     |..|..
  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTN---EIGSQ-YNVKIKWIVADFA 116

  Fly    73 KPPEIECIARKTTERYEGKLDVLVNGAG-IMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQ 136
            |..|:.....|.....|  :.:|||..| |....:|..........::..||.|...||:.:|||
  Fly   117 KGREVYAHIEKELNGIE--VGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQ 179

  Fly   137 LL-QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQ 200
            :: :.||:|||:.|...|:..|||.||..:|..|..||:.|..::....:.|..|.|..:.||:.
  Fly   180 MISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN 244

  Fly   201 ------KAGGM---DEQSYAEFLEHSKKTHALGRIGE 228
                  :.||:   :..|||.     .....||:..|
  Fly   245 SYSDKVRQGGLLFPNAYSYAR-----SAVFTLGKTSE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 70/232 (30%)
NADB_Rossmann 11..261 CDD:304358 70/232 (30%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 70/232 (30%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.