DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Hsdl2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020868.1 Gene:Hsdl2 / 313200 RGDID:1305387 Length:524 Species:Rattus norvegicus


Alignment Length:229 Identity:61/229 - (26%)
Similarity:92/229 - (40%) Gaps:52/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDR----------------EE------EGLICVM 54
            :|..|.||||:.|||.|.|...:|.||.:.:..:                ||      :.|.||:
  Rat     9 AGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQRHPKLLGTIYTAAEEIEAAGGKALPCVV 73

  Fly    55 KRCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGA-GIMPTGTLQSTELACFTHV 118
                           |:....:|.....|..||: |.:|:|||.| .|..|.||: |.......:
  Rat    74 ---------------DVRDEQQINSAVEKAVERF-GGIDILVNNASAISLTNTLE-TPTKRVDLM 121

  Fly   119 MEANVRSGFYLTKLLLPQLLQCK-GSIVNVSSVCGLRA--FPNLVAYNMSKAAVDQFTRSLALDL 180
            |..|.|..:..:|..:|.|.:.| ..|:|:|....|..  |....||.::|..:......:|.:.
  Rat   122 MSVNTRGTYLTSKACIPFLKKSKVAHILNLSPPLNLNPMWFKQHCAYTIAKYGMSMCVLGMAEEF 186

  Fly   181 GPQGVRVNAVNPGVIRTNLQKA-----GGMDEQS 209
            ..: :.|||:.|   ||.:..|     ||...:|
  Rat   187 RGE-IAVNALWP---RTAIHTAAMDMLGGAGVES 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 61/229 (27%)
NADB_Rossmann 11..261 CDD:304358 61/229 (27%)
Hsdl2NP_001020868.1 HSDL2_SDR_c 8..248 CDD:187663 61/229 (27%)
adh_short 12..197 CDD:278532 53/202 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..410
SCP2 424..517 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.