DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG3603

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:251 Identity:75/251 - (29%)
Similarity:122/251 - (48%) Gaps:15/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHE-PYGIAGDLLKPP 75
            :|||.|:|||.||||.|...:.::.||.:..|||   .|....:...::|.| ...:..|:....
  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIAVDR---NLKAAQETVQELGSERSAALEVDVSSAQ 68

  Fly    76 EIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT----KLLLPQ 136
            .::....:..::::....::||.|||...|.|.......:..|...|::..|.:|    |.::.|
  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133

  Fly   137 LLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQK 201
            .|: .|:|||:||:...........|..:||.|..||...:.:.|..|:|||.:.||.|.|.:  
  Fly   134 KLE-NGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPM-- 195

  Fly   202 AGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            ...:.:....|.::..    .|||:|:|:|:|..|.||||..:|:|.|..:.|.||
  Fly   196 VAVVPDSVKQEVVQRC----PLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 73/249 (29%)
NADB_Rossmann 11..261 CDD:304358 75/251 (30%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 75/251 (30%)
BKR_SDR_c 9..248 CDD:187594 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.