DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CG13377

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:115/289 - (39%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEG-----LICVMKRCMKMGHEPYGIAGDLLK 73
            :|||||.|.:.:|.......:..|..:....:|.:.     |:|...:..:...||  |||.:: 
  Fly    46 RVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSEEP--IAGTII- 107

  Fly    74 PPEI----ECIARKTT-------ERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGF 127
            |..:    |.:.|:.|       ...|..:..::|.:|.:..|.::|..:..:.|::..|:....
  Fly   108 PMRLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHMLRTNILGTL 172

  Fly   128 YLTKLLLPQLLQCKGSIVNVSSVCGLRAFPN----LVAYNMSKAAVDQFTRSLALDLGPQGVRVN 188
            .:.|..:..|...:|.::.:..|.|.....|    |||:|.|:.|||:....|..:|.|.||.|.
  Fly   173 RVAKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEELRKELHPYGVSVV 237

  Fly   189 AVNP-GVIRTNLQKA----------GG------------------------MDEQSYAEFLEHSK 218
            |::. |:...:|.||          |.                        :.:|.|| .|.|:|
  Fly   238 ALDTCGMTAESLYKAPVAQTMSLVVGAPTQYTADVLSPDALHVIERALWDYVPQQRYA-LLSHNK 301

  Fly   219 KTHALG-----RIGEPKEVAAAICFLASE 242
            ...||.     |:..|  ||:.:...||:
  Fly   302 YQFALPCRSSLRLQRP--VASTVGESASQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 67/289 (23%)
NADB_Rossmann 11..261 CDD:304358 67/289 (23%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 49/202 (24%)
NADB_Rossmann 46..>237 CDD:304358 46/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.