DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Cbr1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_062043.1 Gene:Cbr1 / 29224 RGDID:2286 Length:277 Species:Rattus norvegicus


Alignment Length:252 Identity:66/252 - (26%)
Similarity:99/252 - (39%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VVLITGAASGIG-AAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEIE 78
            |.|:|||..||| |...::..|....:.|..|:|......:|:....|..|.....|:..|..|.
  Rat     7 VALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTEGLSPRFHQLDIDNPQSIR 71

  Fly    79 CIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT----KLLLPQLLQ 139
            .:.....:.| |.|:||||.|||    ..:..:...|....|..:::.|:.|    |.||| :::
  Rat    72 ALRDFLLQEY-GGLNVLVNNAGI----AFKVVDPTPFHIQAEVTMKTNFFGTQDVCKELLP-IIK 130

  Fly   140 CKGSIVNVSSVCGLRA------------------------------------------FPNLVAY 162
            .:|.:|||||...|||                                          :|| .||
  Rat   131 PQGRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPN-SAY 194

  Fly   163 NMSKAAVDQFTRSLALDLGPQ----GVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLE 215
            .::|..|...:|..|..|..:    .:.:||..||.:||::  ||....:|..|..|
  Rat   195 GVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDM--AGPKATKSPEEGAE 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 66/252 (26%)
NADB_Rossmann 11..261 CDD:304358 66/252 (26%)
Cbr1NP_062043.1 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 66/252 (26%)
adh_short 7..239 CDD:278532 63/240 (26%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)