DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Dhrs1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001007622.1 Gene:Dhrs1 / 290234 RGDID:1359172 Length:313 Species:Rattus norvegicus


Alignment Length:277 Identity:74/277 - (26%)
Similarity:121/277 - (43%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLK 73
            :...|:|.::|||:.|||...|....:.||.:.:..|..:.|....:....:|.....:..|..:
  Rat     3 MTMKGQVCVVTGASRGIGRGIALQLCQAGATVYITGRHLDTLRATAQEAQSLGGRCVPVVCDSSQ 67

  Fly    74 PPEIECIARKTTERYEGKLDVLVNGA-----GIMPTGTLQSTE--LACFTHVMEANVRSGFYL-- 129
            ..|::.:..:.....:|:||||||.|     .|:.|.|....|  .:.:..:....:| |.||  
  Rat    68 ESEVKSLFEQVDREQQGRLDVLVNNAYAGVQAILNTTTKSFWEAPASLWDDINNVGLR-GHYLCS 131

  Fly   130 ---TKLLLPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVN 191
               .:|::|   ..||.||.|||..||:...| |.|.:.|||.|:.....|.:|...||...::.
  Rat   132 VYGARLMVP---AGKGLIVVVSSPGGLQHMFN-VPYGVGKAACDKLAADCAHELRRHGVSYVSLW 192

  Fly   192 PGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELAS-----FVTGVT 251
            ||:::|.:.|.....|:...:.|  .||..::....|..|::.. |.:|  ||:     .::|..
  Rat   193 PGLVQTEMVKEYVAKEEQPEDPL--FKKMKSVLSSAETTEMSGK-CVVA--LATDPNILSLSGKV 252

  Fly   252 LP------------VDG 256
            ||            |||
  Rat   253 LPSCDLARRYGLKDVDG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 74/277 (27%)
NADB_Rossmann 11..261 CDD:304358 74/275 (27%)
Dhrs1NP_001007622.1 PRK08303 1..271 CDD:236229 74/277 (27%)
DHRS1-like_SDR_c 5..271 CDD:187664 74/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.