DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:223 Identity:68/223 - (30%)
Similarity:102/223 - (45%) Gaps:19/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKGKAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGL------ICVMKRCMKMG 61
            ::.||.|  ...||::|||.||:|...|.:|...||.:.|..|..:.|      :..........
  Rat    44 TRSKAYL--RNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQT 106

  Fly    62 HEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSG 126
            |:|..:..||..|..|...|.:..:.: |.:|:|:|.|||...|.:..|.:.....|||.|....
  Rat   107 HQPCVVTFDLADPGAIAPAAAEILQCF-GYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGP 170

  Fly   127 FYLTKLLLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAV 190
            ..|||.|||.:::.| |.||.:||:.|..:.|...||..||.|...|...|..::....:.|..:
  Rat   171 VALTKALLPSMVERKRGHIVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVI 235

  Fly   191 NPGVIRTNL---------QKAGGMDEQS 209
            :||.|.|||         .:.|.:|:.:
  Rat   236 SPGYIHTNLSVNAVTADGSRYGALDKNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 66/217 (30%)
NADB_Rossmann 11..261 CDD:304358 65/215 (30%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 66/217 (30%)
PRK06181 52..321 CDD:235726 65/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.