DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and oar2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 / 2543512 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:66/254 - (25%)
Similarity:117/254 - (46%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLITGAASGIGAAAAEMFSKLGACLALVDREEEGL------ICVMKRCMKMGHEPYGIAGDLLKP 74
            |||||.:||:|...|:::|:.|....:|.|.|..|      :.|.|     |.:      ..|..
pombe     4 VLITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAK-----GQQ------HTLTI 57

  Fly    75 PEIECIARKTTERYEG-KLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLL 138
            .:::...:.....:|. ::|.:|:.||::.:.....|.......::..|:.|...|:|:.:.:..
pombe    58 ADVQSDMKNLKSIFESVEIDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWF 122

  Fly   139 QCKGS-----IVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTN 198
            :.|.|     |:|:||.....|.|....|..|||.::.||:.||.::..:|:||||::||.:.|.
pombe   123 RNKNSERDRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTP 187

  Fly   199 LQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            :..         ::....::|...:||:....|:..|..||...  .:.||..||:.||
pombe   188 MLS---------SQIRAIAEKKVPIGRLASTDEIVDACTFLLDN--RYTTGTILPITGG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/252 (25%)
NADB_Rossmann 11..261 CDD:304358 66/254 (26%)
oar2NP_594074.1 FabG 1..236 CDD:223959 66/254 (26%)
SDR_c 4..233 CDD:212491 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1456
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.