DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:80/262 - (30%)
Similarity:131/262 - (50%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALV-DREEEGLICVMKRCMKMGHEPYGIAGDLLK-PP 75
            ||..||||.:.|||.:.|:.|:..|:.:.|: .|.::.|....:.     .:.:|:...... |.
pombe     9 GKTTLITGGSGGIGFSIAKAFAAAGSNVGLLYGRNKKALEYAAEL-----RDKHGVQAKAYSCPI 68

  Fly    76 EIECIARKTT----ERYEGKLDVLVNGAGI-MPTGTLQSTELACFTHVMEANVRSGFYLTKLLLP 135
            |......:||    |...|:|||::..||| :|..:|:......:|.|:..|:...:|..:....
pombe    69 ENRSAVIETTNQAVEELGGRLDVMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGH 133

  Fly   136 QL-LQCKGSIVNVSSVCG-LRAFP-NLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT 197
            .. .|.|||::..:|:.| :..:| ...:|:.:||||....|:||::..| ..|||:|:||.|.|
pombe   134 HFKKQGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEWAP-FARVNSVSPGYIDT 197

  Fly   198 NLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQVMC 262
            :|....  ||....::.|::.:    .|||.|.|:..|..:|||:.:|:.||..:.||||   .|
pombe   198 DLTLYA--DENLRKKWKEYTPQ----ARIGLPDELPGAYLYLASDASSYCTGSDIIVDGG---YC 253

  Fly   263 PR 264
            .|
pombe   254 SR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 76/253 (30%)
NADB_Rossmann 11..261 CDD:304358 78/257 (30%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 78/257 (30%)
MDH-like_SDR_c 2..254 CDD:187610 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.