DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and SPAC22A12.17c

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_593247.1 Gene:SPAC22A12.17c / 2541844 PomBaseID:SPAC22A12.17c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:252 Identity:71/252 - (28%)
Similarity:111/252 - (44%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLK 73
            |...||..::.|.|.|||.|...:|::.||...:|.....|.....:.....|.:.|....|:..
pombe    17 LSLKGKNAVVFGGARGIGHAICSVFAEAGANAFIVYNTTPGEKAAKEIAQANGVKTYTCKCDVTI 81

  Fly    74 PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQL- 137
            |.|:|....:..:.:: .:|::|...||....:........|.:.:..|:...|.:.....|.. 
pombe    82 PKEVEHAFAEIQKVFD-TIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGPIFQ 145

  Fly   138 LQCKGSIVNVSSVCG--LRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQ 200
            .|..||:|..:|:.|  :.......|||.|||.|.|..:|||:: ..:..|||.|:||.  |...
pombe   146 KQGHGSLVATASMSGVVVNVPQQQCAYNTSKAGVIQLIKSLAVE-WRKFARVNCVSPGY--TTSD 207

  Fly   201 KAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            ..||...:.:..:....       |.|..||:|:|..:|||:.||:.:|..|.||||
pombe   208 MTGGKFHKEWEPYTPFE-------RNGLAKEIASAYLYLASDAASYASGTNLIVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 69/250 (28%)
NADB_Rossmann 11..261 CDD:304358 70/250 (28%)
SPAC22A12.17cNP_593247.1 MDH-like_SDR_c 14..260 CDD:187610 71/252 (28%)
fabG 18..257 CDD:235500 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.