DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Rdh8

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:266 Identity:78/266 - (29%)
Similarity:115/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIA-----GDLLK 73
            :.|||:|.:||||.       :|...||...|:...::..|:...|  .||...|     |..|.
Mouse     6 RTVLISGCSSGIGL-------ELALQLAHDPRQRYQVVATMRDLGK--KEPLEAAAGEALGKTLS 61

  Fly    74 PPEIE-CIARKTTERYE----GKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLL 133
            ..::: |.....|:...    |::|||||.||:...|.|:...||....|...|......|.|.:
Mouse    62 VVQLDVCNDESVTDCLSHIEGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAV 126

  Fly   134 LPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT 197
            ||.:.:.: |.||.||||.||:.......|..||.|::.|..|||:.|....:.::.|.||.:.|
Mouse   127 LPGMKRRRQGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVTT 191

  Fly   198 NLQKAGGMDEQ-SYAEFLEHSKKTHALGR-------------IGE-PKEVAAAICFLASELASFV 247
            :.:  |.:..| |.|||.:....|....|             :|: |::||..|        :.|
Mouse   192 DFE--GKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVI--------AKV 246

  Fly   248 TGVTLP 253
            .|.|.|
Mouse   247 IGTTRP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 78/266 (29%)
NADB_Rossmann 11..261 CDD:304358 78/266 (29%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 78/266 (29%)
adh_short 6..201 CDD:278532 62/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.