DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Cbr4

DIOPT Version :10

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_663570.2 Gene:Cbr4 / 234309 MGIID:2384567 Length:236 Species:Mus musculus


Alignment Length:43 Identity:12/43 - (27%)
Similarity:15/43 - (34%) Gaps:14/43 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SVWDNVYQTLICCPPEEVLQTCADFLNVTKSFCPTGHSNDCYI 167
            |.||         .|...|||     ....::|..|..||.|:
Mouse   122 SDWD---------APRGTLQT-----GPAPNYCVIGVVNDSYV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 Rossmann-fold NAD(P)(+)-binding proteins 11..261 CDD:473865 12/43 (28%)
Cbr4NP_663570.2 Rossmann-fold NAD(P)(+)-binding proteins 3..232 CDD:473865 12/43 (28%)

Return to query results.
Submit another query.