Sequence 1: | NP_730973.1 | Gene: | CG31546 / 40691 | FlyBaseID: | FBgn0051546 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663403.1 | Gene: | Dhrs7b / 216820 | MGIID: | 2384931 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 68/209 - (32%) |
---|---|---|---|
Similarity: | 103/209 - (49%) | Gaps: | 15/209 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKR----CMKMGHEPYGIAGDLLKPP 75
Fly 76 EIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQC 140
Fly 141 K-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNL----- 199
Fly 200 ----QKAGGMDEQS 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31546 | NP_730973.1 | fabG | 9..257 | CDD:235975 | 68/209 (33%) |
NADB_Rossmann | 11..261 | CDD:304358 | 68/209 (33%) | ||
Dhrs7b | NP_663403.1 | 11beta-HSD1_like_SDR_c | 50..309 | CDD:187593 | 68/209 (33%) |
PRK06181 | 52..319 | CDD:235726 | 68/209 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830577 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |