DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and ZK829.1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_502263.1 Gene:ZK829.1 / 191434 WormBaseID:WBGene00014093 Length:284 Species:Caenorhabditis elegans


Alignment Length:275 Identity:89/275 - (32%)
Similarity:149/275 - (54%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGI---AG 69
            |..||||||||:|::.|||.|.|..|:..||.:.|..|..:.:....|.||::|.:|:.:   .|
 Worm     3 GTRFSGKVVLISGSSKGIGQATAVKFAAEGAKIVLNGRSADDVEKTRKLCMEVGAKPWDLLPTVG 67

  Fly    70 DLLKPPEIECIARKTTERYEGKLDVLVNGAGIMP---TGTLQSTELACFTHVME----ANVRSGF 127
            |:.....::.:.......: ||||:|:|.||.:.   ||. :..|:.  ..||:    :|.:|..
 Worm    68 DITNEDFVKMMVNTVIHNF-GKLDILINNAGTLEVDMTGK-EGWEMG--VDVMDRSWNSNFKSVL 128

  Fly   128 YLTKLLLPQLLQCKGSIVNVSSV-----CGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRV 187
            .||:..:|.|::.||.|||||:.     .|:.:.|   .|.:.|||:||.:||:|.:...:|||:
 Worm   129 MLTQAAMPHLIKTKGDIVNVSTFLSSGPIGVMSMP---YYAVPKAALDQMSRSMAHEYMLKGVRL 190

  Fly   188 NAVNPGVIRTN----LQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLAS-ELASFV 247
            |.||||::.|:    |...|..:.:....:::...:...|||:.:..:||..|.|||. :::..:
 Worm   191 NTVNPGLVSTSFFARLPGVGDDNARKMENYVQSKTEYIPLGRVCQASDVAETILFLADRKVSECI 255

  Fly   248 TGVTLPVDGGKQVMC 262
            .|.::.:|||.::.|
 Worm   256 VGQSIIIDGGSRLCC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 85/267 (32%)
NADB_Rossmann 11..261 CDD:304358 87/269 (32%)
ZK829.1NP_502263.1 FabG 5..265 CDD:223959 85/266 (32%)
NADB_Rossmann 6..268 CDD:304358 87/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.