DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and dhs-31

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001255457.1 Gene:dhs-31 / 188051 WormBaseID:WBGene00011424 Length:254 Species:Caenorhabditis elegans


Alignment Length:271 Identity:68/271 - (25%)
Similarity:103/271 - (38%) Gaps:80/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHE--------------P 64
            |.|.||||..|||         ||....|:...|..:|....|.::..:|              .
 Worm     4 KTVFITGANRGIG---------LGIVRKLLKVSEIEVIIAGARNLEAANELRELAKADNRLHAIT 59

  Fly    65 YGIAGDLLKPPEIECIAR--KTTERYEGK--LDVLVNGAGI--------MPTGTLQSTELACFTH 117
            ..:|.|       |.:|.  |..|...|.  |::|:|.||.        .|:   :...|.||  
 Worm    60 VDVAND-------ERLANSVKQVESLVGDRGLNLLINNAGCYELYETTDSPS---RKASLKCF-- 112

  Fly   118 VMEANVRSGFYLTKLLLPQLLQC------------KGSIVNVSSVCG---LRAFPNL----VAYN 163
              :.|.......::|.||.|.:.            :.:|:|:.|.|.   |...|.:    :||.
 Worm   113 --DVNAVGSLMASQLFLPLLKKAAAHTHITGLSASRAAILNIGSDCSSQFLNGTPTVNDVSIAYK 175

  Fly   164 MSKAAVDQFTRSLALDLGPQG--VRVNAVNPGVIRTNLQKAGGMD-----EQSYAEFLEHSKK-- 219
            |||.|:..|.||||.|.....  |.:..::||.:.|.:   ||.|     |:|..:.::..::  
 Worm   176 MSKVAMLSFARSLASDFRTLNIPVLIATIHPGWVLTEM---GGSDAEITVEESATDIVDSIERLN 237

  Fly   220 THALGRIGEPK 230
            |...|.:.|.|
 Worm   238 TSHQGGLFERK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 68/271 (25%)
NADB_Rossmann 11..261 CDD:304358 68/271 (25%)
dhs-31NP_001255457.1 adh_short 4..216 CDD:278532 60/237 (25%)
NADB_Rossmann 6..254 CDD:304358 67/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.