DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and F20G2.1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_506406.1 Gene:F20G2.1 / 184742 WormBaseID:WBGene00008985 Length:249 Species:Caenorhabditis elegans


Alignment Length:253 Identity:65/253 - (25%)
Similarity:99/253 - (39%) Gaps:79/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSK-------LGAC-------------------LAL-VDREEEGLI 51
            |.:|||||..|||....:.|.|       :|.|                   |.| :|.::.   
 Worm     4 KSILITGANRGIGLGLLKQFIKNKDVQIIIGTCRDPSNATELNSIKDTRVHILQLDIDCDDS--- 65

  Fly    52 CVMKRCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGI-MPTGTLQSTELACF 115
                 ..|:|.|...:.|                   |..|.||:|.||| :|.........:..
 Worm    66 -----IRKLGAEVEKLVG-------------------EDGLTVLINNAGIFVPYDIDGEKSRSTL 106

  Fly   116 THVMEANVRSGFYLTKLLLPQLLQC------------KGSIVNVSSVCG----LRAFPN--LVAY 162
            ...:|.|..|...:|:.|||.|.:.            :.:|:|:||..|    :.|..|  ||||
 Worm   107 IRQLETNTISTVLITQELLPLLKRAAAKNRGEGYSINRSAIINISSTAGSITKIDASYNIPLVAY 171

  Fly   163 NMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKT 220
            .|||:|::.|.:|.::||....:.|....||.::|::..|.|..|      ::.:.||
 Worm   172 RMSKSALNSFGKSCSVDLAKYHILVTTFCPGWVKTDMGGANGKLE------IDDATKT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 65/253 (26%)
NADB_Rossmann 11..261 CDD:304358 65/253 (26%)
F20G2.1NP_506406.1 adh_short 4..208 CDD:278532 60/230 (26%)
carb_red_sniffer_like_SDR_c 6..248 CDD:187586 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.