DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and C06B8.3

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_506855.2 Gene:C06B8.3 / 182298 WormBaseID:WBGene00007369 Length:162 Species:Caenorhabditis elegans


Alignment Length:148 Identity:50/148 - (33%)
Similarity:79/148 - (53%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 MEANVRSGFYLTKLLLPQLLQCKGSIVNVSSVC-GLRAFPNLVAYNMSKAAVDQFTRSLALDLGP 182
            |:.|:||...|.:.....|::.||.|:||||:. |......:..|.||||.::.||||.|:.|..
 Worm     1 MQINMRSVITLVQKAKEHLIKTKGEIINVSSIASGPHGDSQMTYYGMSKADLNHFTRSSAISLIQ 65

  Fly   183 QGVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEH---SKKTHALGRIGEPKEVAAAICFLASE-L 243
            .|||||:|:||...|....|.|....:..:.::|   .|:....|.:..|.::|..|.|||.. :
 Worm    66 HGVRVNSVSPGFTLTGFGDAMGFPPGALEKVIKHYASHKECIPSGVVARPGDIAQIILFLADRTM 130

  Fly   244 ASFVTGVTLPVDGGKQVM 261
            :|::.|.::..|||..::
 Worm   131 SSYIIGQSIIADGGSSLV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 48/142 (34%)
NADB_Rossmann 11..261 CDD:304358 50/146 (34%)
C06B8.3NP_506855.2 NADB_Rossmann <1..148 CDD:304358 50/146 (34%)
FabG <1..144 CDD:223959 48/142 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.