DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and stdh-1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_506449.1 Gene:stdh-1 / 182291 WormBaseID:WBGene00007363 Length:314 Species:Caenorhabditis elegans


Alignment Length:273 Identity:68/273 - (24%)
Similarity:109/273 - (39%) Gaps:54/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KGKAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIA 68
            |.|||..::    ::|||..|||.:.:...:|.|..:.:|.|.:..|....|..::: |      
 Worm    42 KKKAGASWA----VVTGATDGIGKSYSFELAKRGFNVYIVSRTQSKLEHTKKEILEV-H------ 95

  Fly    69 GDLLKPPEIEC------IARKTTERYE---GKLD-----VLVNGAGIM---P------TGTLQST 110
                  |:||.      ....:...||   .||:     :|:|..|:.   |      .|.:.| 
 Worm    96 ------PDIEVRFATFDFTNPSVSDYEKLLSKLNEVSIGILINNVGMFFDYPEMLHKINGGIDS- 153

  Fly   111 ELACFTHVMEANVRSGFYLTKLLLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTR 174
                ..:|...|......|:..:|||::..| |.|||:.||.||........|:.:|..|:..|.
 Worm   154 ----IANVTIINTLPATLLSAGILPQMVPRKAGIIVNIGSVAGLATMAEWSVYSATKKYVEWITG 214

  Fly   175 SLALDLGPQGVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAI--- 236
            .|..:.|.||:...|:.|.::.|.:  ||..:...:....:...|: ||..||...:....|   
 Worm   215 CLQKEYGHQGIIFQAITPAMVATKM--AGNPNTSFFTPDSDTFAKS-ALNTIGHASQTTGYITHQ 276

  Fly   237 --CFLASELASFV 247
              |.:...|..||
 Worm   277 IECEMLKLLPDFV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/268 (24%)
NADB_Rossmann 11..261 CDD:304358 64/266 (24%)
stdh-1NP_506449.1 17beta-HSD1_like_SDR_c 47..289 CDD:187614 62/266 (23%)
adh_short 49..242 CDD:278532 53/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.