DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Cbr1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_031646.2 Gene:Cbr1 / 12408 MGIID:88284 Length:277 Species:Mus musculus


Alignment Length:254 Identity:72/254 - (28%)
Similarity:103/254 - (40%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIG-AAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPP 75
            |..|.|:|||..||| |...::..|....:.|..|:||.....:::....|..|.....|:..|.
Mouse     4 SRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQ 68

  Fly    76 EIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLT----KLLLPQ 136
            .|..:.....:.| |.||||||.|||    ..:..:...|....|..:::.|:.|    |.||| 
Mouse    69 SIRALRDFLLKEY-GGLDVLVNNAGI----AFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLP- 127

  Fly   137 LLQCKGSIVNVSSVCGLRAFPN------------------LV----------------------- 160
            |::.:|.:|||||:..|||..|                  ||                       
Mouse   128 LIKPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNS 192

  Fly   161 AYNMSKAAVDQFTRSLALDLGPQ----GVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLE 215
            ||.::|..|...:|.||..|..|    .:.:||..||.:||::  ||....:|..|..|
Mouse   193 AYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDM--AGPKATKSPEEGAE 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 72/254 (28%)
NADB_Rossmann 11..261 CDD:304358 72/254 (28%)
Cbr1NP_031646.2 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 71/251 (28%)
adh_short 7..239 CDD:278532 68/239 (28%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)