DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and DHRS2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens


Alignment Length:250 Identity:73/250 - (29%)
Similarity:123/250 - (49%) Gaps:6/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLDFSG----KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIA 68
            |:|..|    :|.::||:.||||.|.|...::.||.:.:..|:::.:...|.:....|....||.
Human    27 GIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGIV 91

  Fly    69 GDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMP-TGTLQSTELACFTHVMEANVRSGFYLTKL 132
            ..:.|..:.|.:..|..| :.|.:|.||..||:.| .|:...|....:..::..||:|...|...
Human    92 CHVGKAEDREQLVAKALE-HCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQ 155

  Fly   133 LLPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT 197
            |||.:...:|:::.|||:........|..||:||.|:...||:|||:|.|:.:|||.|.||:|:|
Human   156 LLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKT 220

  Fly   198 NLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTL 252
            :..|...:.....:.....|:...:...:|..:.|..:....|.::.:..||.||
Human   221 DFSKVVRIGFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 71/248 (29%)
NADB_Rossmann 11..261 CDD:304358 70/246 (28%)
DHRS2NP_878912.1 SDR 27..>226 CDD:330230 65/199 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.