DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and hsd17b14

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:282 Identity:82/282 - (29%)
Similarity:133/282 - (47%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKGKAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLI------------CVMK 55
            |..:..|.:..:|.:|||...|||.|..:.|.|.||.:....::.|...            |:..
 Frog     4 SGAELSLRYRDRVAVITGGTKGIGEAMVKEFVKSGARVVFCSKDTEAKALENEIKAAGPGDCIYV 68

  Fly    56 RCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAG-IMPTGTLQSTELACFTHVM 119
            .|            |:.|..:|:.:...|...| |::|.|:|.|| ..|..|:..|....|..::
 Frog    69 CC------------DVTKEEDIKKLIEITVMNY-GQIDCLINNAGWHPPEQTIDGTSADDFRDLL 120

  Fly   120 EANVRSGFYLT-KLLLPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQ 183
            ..|: .|::|| |..||.|.:.:|:|:|:||:.|:....:.:.|..:|.||...|:::|:|....
 Frog   121 NLNL-IGYFLTAKYALPHLRKTQGNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRH 184

  Fly   184 GVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHA----------LGRIGEPKEVAAAICF 238
            .||:|:::||.|.|.|          :.|...|||.:.|          |||:|..:|.|.|..:
 Frog   185 NVRINSISPGNIWTPL----------WEELSSHSKNSEAMIQGGIDAQLLGRMGTAEECAKAALY 239

  Fly   239 LASELASFVTGVTLPVDGGKQV 260
            ||:| .:|.||:.|.:.||.::
 Frog   240 LAAE-GTFCTGIDLLLTGGAEL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 79/271 (29%)
NADB_Rossmann 11..261 CDD:304358 80/274 (29%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 81/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.