DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and XB5863530

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:213 Identity:65/213 - (30%)
Similarity:99/213 - (46%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KAGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRC-MKMGHEPYGIAG 69
            |..|...|...::|||..|||.:.||..::.|..:.|:.|..|.|..|.:.. .|.|.:...|..
 Frog    71 KPNLRQYGTWAVVTGATDGIGKSYAEELARRGFDIVLISRSPEKLQRVAEGIEQKSGRKTKIIQA 135

  Fly    70 D------LLKPPEIECIARKTTERYEG-KLDVLVNGAGIMPTGTLQSTELACF----------TH 117
            |      :..|.|         |..:| .:.||||..|:     ..|.|...|          |:
 Frog   136 DYTGDVGIYTPIE---------EGLKGLDIGVLVNNVGM-----AYSNEPVRFLDVPNVKERLTN 186

  Fly   118 VMEANVRSGFYLTKLLLPQLL-QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLG 181
            |:..|:.|...:|:::||.:| :.||.|:|:||..|...||.:..|:.:|..||.|:|.|..:..
 Frog   187 VINCNIVSVLQMTRIVLPGMLKKKKGLIINISSEAGSHPFPMVAVYSSTKVFVDYFSRCLHTEYS 251

  Fly   182 PQGVRVNAVNPGVIRTNL 199
            |||:.|.:|.|.::.||:
 Frog   252 PQGITVQSVMPLLVSTNM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/210 (30%)
NADB_Rossmann 11..261 CDD:304358 63/208 (30%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.