DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and SPS19

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:78/255 - (30%)
Similarity:119/255 - (46%) Gaps:17/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGAGT-----SVLLAKLGGLLTIVGRNLDKLNETAEQI--VAAGGAPALQV 61
            ||.||..|||     ||||     :..|..||....||||:.::..:.|:.|  :|......|.:
Yeast    22 FKGKVAFVTG-----GAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAI 81

  Fly    62 A-ADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHL 125
            | .|:.:...|:..|..|:.|.|:||.::..|....:....|.|...|..|::.::...:.....
Yeast    82 ANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKA 146

  Fly   126 VTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            ...||.|:||:|:.||:.......|.......:||.:|...:.:|:||.|.|:|.|.:.||.|  
Yeast   147 CLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAI-- 209

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
              ....||.:.|..|:.|.|.....|.|.|..:::|.:..::.|..||:.||..|.||||
Yeast   210 --DNTEGLKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/255 (31%)
NADB_Rossmann 4..254 CDD:304358 78/255 (31%)
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.